missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FBXL3 (aa 79-156) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105361
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111604 (PA5-111604. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs, which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats and is localized in the nucleus.Specifications
Q9UKT7 | |
Blocking Assay, Control | |
26224 | |
100 μL | |
Afh; AU041772; AW212966; FBK; FBL3; Fbl3a; F-box and leucine rich repeat protein 3; F-box and leucine-rich repeat protein 3; F-box and leucine-rich repeat protein 3 A; F-box protein Fbl3a; F-box/LRR-repeat protein 3; F-box/LRR-repeat protein 3 A; FBXL3; Fbxl3a; Ovtm; Play68; Protein after-hours; protein overtime | |
FBXL3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human FBXL3 (aa 79-156) Control Fragment | |
RUO | |
FBXL3 | |
Unconjugated | |
Recombinant | |
FEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARPSFMDLP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |