missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FAM179B (aa 474-570) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100014
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62807 (PA5-62807. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Required for normal structure and function of primary cilia. Plays a role in the organization of axoneme microtubule bundles in primary cilia. Interacts with microtubules and promotes microtubule polymerization via its HEAT repeat domains, especially those in TOG region 2 and 4.Specifications
| Q9Y4F4 | |
| Blocking Assay, Control | |
| 23116 | |
| 100 μL | |
| Crescerin-1; FAM179B; family with sequence similarity 179 member B; family with sequence similarity 179, member B; KIAA0423; Protein FAM179B; TOG array regulator of axonemal microtubules protein 1; TOGARAM1 | |
| TOGARAM1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FAM179B (aa 474-570) Control Fragment | |
| RUO | |
| FAM179B | |
| Unconjugated | |
| Recombinant | |
| LLLEHLKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTSILFKAVDTVELQDNGDGVMNAVQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |