missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FADS3 (aa 19-69) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100011
Description
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60956 (PA5-60956. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization.Specifications
Q9Y5Q0 | |
Blocking Assay, Control | |
3995 | |
100 μL | |
AI464531; CYB5RP; cytochrome b5-related protein; delta(13) desaturase; Delta(13) fatty acid desaturase; delta-9 fatty acid desaturase; delta-9-desaturase; FADS3; Fatty acid desaturase 3; fatty acid desaturase 3; LOW QUALITY PROTEIN: fatty acid desaturase 3; linoleoyl-CoA desaturase (delta-9-desaturase)-like 3; LLCDL3; MNCb-0629; putative fatty acid desaturase | |
FADS3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human FADS3 (aa 19-69) Control Fragment | |
RUO | |
FADS3 | |
Unconjugated | |
Recombinant | |
PLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAED | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |