missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ESRRG (aa 65-125) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100467
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Estrogen-related receptor gamma (ERRG, ERR3, NR3B3) is an orphan member of the nuclear hormone receptor superfamily. ERRG acts as a transcription activator in the absence of a bound ligand. It binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements. ERRG also induces the expression of PERM1 in the skeletal muscle.Specifications
| P62508 | |
| Blocking Assay, Control | |
| 2104 | |
| 100 μL | |
| DKFZp781L1617; ERR gamma; ERR gamma-2; ERR3; errg; ERRG2; ERRgamma; ESRRG; Estrogen receptor-related protein 3; estrogen related receptor gamma; estrogen-related receptor 3; estrogen-related receptor gamma; FLJ16023; Kiaa0832; mKIAA0832; NR3B3; Nuclear receptor subfamily 3 group B member 3 | |
| Esrrg | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ESRRG (aa 65-125) Control Fragment | |
| RUO | |
| ESRRG | |
| Unconjugated | |
| Recombinant | |
| SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |