missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ESRP2 (aa 649-727) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104859
Description
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83919 (PA5-83919. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
RBM35A, also known as ESRP2, is a mRNA splicing factor that with its related protein RBM35A (ESRP1) are coordinators of an epithelial cell-type-specific splicing program. Both RBM35B and RBM35A are involved in posttranscriptional regulation of a number of genes such as FGFR2, CD44, CTNND1, and ENAH by exerting a differential effect on protein translation via 5' UTRs of mRNAs, suggesting that these proteins are global regulators of an epithelial regulatory network. Loss of this global ESRP-regulated epithelial splicing program induces the phenotypic changes in cell morphology that are observed during the epithelial-mesenchymal transition.Specifications
| Q9H6T0 | |
| Blocking Assay, Control | |
| 80004 | |
| 100 μL | |
| 9530027K23Rik; Epithelial splicing regulatory protein 2; ESRP2; PP7059; RBM35B; RGD1310855; RNA binding motif protein 35 A; RNA binding motif protein 35 B; RNA-binding motif protein 35 B; RNA-binding protein 35 B | |
| ESRP2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ESRP2 (aa 649-727) Control Fragment | |
| RUO | |
| ESRP2 | |
| Unconjugated | |
| Recombinant | |
| TTVGYLTTPTAALASAPTSVLSQSGALVRMQGVPYTAGMKDLLSVFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |