missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human eIF4E (aa 1-38) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104920
Description
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84061 (PA5-84061. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
eIF4E is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export. All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). EIF4E is a eukaryotic translation initiation factor involved in directing ribosomes to the cap structure of mRNAs. It is a 24-kD polypeptide that exists as both a free form and as part of a multiprotein complex termed EIF4F. The EIF4E polypeptide is the rate-limiting component of the eukaryotic translation apparatus and is involved in the mRNA-ribosome binding step of eukaryotic protein synthesis. The other subunits of EIF4F are a 50-kD polypeptide, termed EIF4A, that possesses ATPase and RNA helicase activities, and a 220-kD polypeptide, EIF4G.Specifications
P06730 | |
Blocking Assay, Control | |
1977 | |
100 μL | |
AUTS19; CBP; EG668879; EIF4E; EIF-4 E; EIF4E1; EIF4EL1; Eif4e-ps; EIF4F; eIF-4 F 25 kDa subunit; eukaryotic translation initiation factor 4 E; eukaryotic translation initiation factor 4 E-like 1; eukaryotic translation initiation factor 4 E-like protein; eukaryotic translation initiation factor 4-like protein; If4e; MGC111573; mRNA cap-binding protein; OTTHUMP00000219703; OTTHUMP00000219704; OTTHUMP00000219705; translation initiation factor eIF-4 E | |
Eif4e | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human eIF4E (aa 1-38) Control Fragment | |
RUO | |
eIF4E | |
Unconjugated | |
Recombinant | |
MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |