missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DLG7 (aa 473-570) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109804
Description
Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144993 (PA5-144993. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells and mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. The protein is also a key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.Specifications
Q15398 | |
Blocking Assay, Control | |
9787 | |
100 μL | |
C77459; C86398; DAP-5; discs large homolog 7; discs large homolog associated protein 5; discs, large (Drosophila) homolog-associated protein 5; discs, large homolog 7; discs, large homolog-associated protein 5; disks large-associated protein 5; Disks large-associated protein DLG7; DLG associated protein 5; DLG7; DLGAP5; Hepatoma up-regulated protein; hepatoma up-regulated protein homolog; HURP; Kiaa0008; mKIAA0008 | |
DLGAP5 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human DLG7 (aa 473-570) Control Fragment | |
RUO | |
DLG7 | |
Unconjugated | |
Recombinant | |
QTRLLMKERFKQFEGLVDDCEYKRGIKETTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQVNNNMNHNMNKNVFRKKVVSGIASKPKQDDAGRI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |