missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DLG5 (aa 867-973) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105684
Description
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64881 (PA5-64881. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May play a role at the plasma membrane in the maintenance of the structure of epithelial cells and in the transmission of extracellular signals to the membrane and cytoskeleton.Specifications
| Q8TDM6 | |
| Blocking Assay, Control | |
| 9231 | |
| 100 μL | |
| 4933429D20Rik; discs large homolog 5; discs large MAGUK scaffold protein 5; discs large protein LP-DLG; discs large protein P-dlg; discs, large homolog 5; discs, large homolog 5 (Drosophila); disks large homolog 5; DLG5; KIAA0583; large type of P-DLG; LP-DLG; mKIAA0583; PDLG; P-DLG5; Placenta and prostate DLG; T25557 | |
| Dlg5 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human DLG5 (aa 867-973) Control Fragment | |
| RUO | |
| DLG5 | |
| Unconjugated | |
| Recombinant | |
| FLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSI | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |