missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DEK (aa 303-362) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104158
Description
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62975 (PA5-62975. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
DEK is a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA, and is also involved in splice site selection during mRNA processing. Chromosomal aberrations involving this region, increased expression of this gene, and the presence of antibodies against this protein are all associated with various diseases.Specifications
P35659 | |
Blocking Assay, Control | |
7913 | |
100 μL | |
1810019E15Rik; D13H6S231E; D6S231E; DEK; DEK oncogene (DNA binding); DEK proto-oncogene; protein DEK | |
DEK | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human DEK (aa 303-362) Control Fragment | |
RUO | |
DEK | |
Unconjugated | |
Recombinant | |
SEDSSDDEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTER | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |