missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human COMMD10 (aa 62-118) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP108056
Description
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140077 (PA5-140077. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The COMMD family represents a group of evolutionary conserved proteins that share a common COMM domain at their extreme C-terminus, which provides an interface for protein-protein interactions. COMMD10 (COMM domain containing 10), also known as PTD002 or HSPC305, is a 202 amino acid protein that belongs to the COMMD family and contains one COMM domain. The gene encoding COMMD10 maps to human chromosome 5, which contains 181 million base pairs and comprises nearly 6% of the human genome. Deletion of the p arm of chromosome 5 leads to Cri du chat syndrome, while deletion of the q arm or of chromosome 5 altogether is common in therapy-related acute myelogenous leukemias and myelodysplastic syndrome. May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). May down-regulate activation of NF-kappa-B.Specifications
Q9Y6G5 | |
Blocking Assay, Control | |
51397 | |
100 μL | |
2310003A05Rik; AU019438; COMM domain containing 10; COMM domain-containing protein 10; COMMD10; Down-regulated in W/WV mouse stomach 2; DRWMS2; HSPC305; mDRWMS2; PTD002 | |
COMMD10 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human COMMD10 (aa 62-118) Control Fragment | |
RUO | |
COMMD10 | |
Unconjugated | |
Recombinant | |
SLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |