missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CEACAM18 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100001
Description
Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63736 (PA5-63736. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CEACAM18 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 18) is a Protein Coding gene. An important paralog of this gene is CEACAM5.Specifications
| A8MTB9 | |
| Blocking Assay, Control | |
| 729767 | |
| 100 μL | |
| carcinoembryonic antigen related cell adhesion molecule 18; carcinoembryonic antigen-related cell adhesion molecule 18; CEACAM18 | |
| CEACAM18 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CEACAM18 Control Fragment | |
| RUO | |
| CEACAM18 | |
| Unconjugated | |
| Recombinant | |
| TSQASGQIFITQTLGIKGYRTVVALDKVPEDVQEYSWYWGANDSAGNMIISHKPPSAQQPGPMYTGRERVNREGSLLIRPTAL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |