missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CDX4 (aa 225-284) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100064
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63315 (PA5-63315. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of a small subfamily of homeobox containing transcription factors. The encoded protein may regulate homeobox gene expression during anteroposterior patterning and hematopoiesis.Specifications
| O14627 | |
| Blocking Assay, Control | |
| 1046 | |
| 100 μL | |
| caudal type homeo box 4; caudal type homeobox 4; caudal type homeobox transcription factor 4; caudal-type homeobox protein 4; Cdx3; Cdx-3; CDX4; Cdx-4; Homeobox protein CDX-4; RGD1561529 | |
| CDX4 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CDX4 (aa 225-284) Control Fragment | |
| RUO | |
| CDX4 | |
| Unconjugated | |
| Recombinant | |
| RAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |