missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human C17orf62 (aa 125-187) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100457
Description
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61073 (PA5-61073. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
C17orf62 is a protein coding gene.Specifications
| Q9BQA9 | |
| Blocking Assay, Control | |
| 79415 | |
| 100 μL | |
| C17orf62; chromosome 17 open reading frame 62; CYBC1; Cytochrome b-245 chaperone 1; EROS; Essential for reactive oxygen species protein; HAPSTR1; uncharacterized protein C17orf62 | |
| C17ORF62 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human C17orf62 (aa 125-187) Control Fragment | |
| RUO | |
| C17orf62 | |
| Unconjugated | |
| Recombinant | |
| MVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |