missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human C11orf84 (aa 209-301) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104895
Description
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65609 (PA5-65609. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Negatively regulates the transcriptional activator activity of SPIN1 via inhibition of its histone methyl-binding ability. Represses the expression of a number of SPIN1-regulated genes and the SPIN1-mediated activation of the Wnt signaling pathway. Can also inhibit the histone methyl-binding abilities of SPIN2A, SPIN2B, SPIN3 and SPIN4 (PubMed:29061846). [UniProt]Specifications
| Q9BUA3 | |
| Blocking Assay, Control | |
| 144097 | |
| 100 μL | |
| C11orf84; chromosome 11 open reading frame 84; hypothetical protein BC007540; SPIN1-docking protein; Spindlin interactor and repressor of chromatin-binding protein; SPINDOC; SPIN-DOC; uncharacterized protein C11orf84 | |
| C11orf84 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human C11orf84 (aa 209-301) Control Fragment | |
| RUO | |
| C11orf84 | |
| Unconjugated | |
| Recombinant | |
| PGNKKPRGQRWKEPPGEEPVRKKRGRPMTKNLDPDPEPPSPDSPTETFAAPAEVRHFTDGSFPAGFVLQLFSHTQLRGPDSKDSPKDREVAEG | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |