missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ASAP1 (aa 957-1078) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104260
Description
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61770 (PA5-61770. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ASAP1, also known as Development and differentiation enhancing factor 1, is a protein with two ANK repeats, an Arf-GAP domain, a PH domain and a SH3 domain. ASAP1 is a homodimer known to interact with SRC and CRK and its activity is stimulated by phosphatidylinositol 4,5-biphosphate (PIP2). It possesses phosphatidylinositol 4,5-biphosphate-dependent GTPase-activating protein activity for ARF1 (ADP ribosylation factor 1) and ARF5 and a lesser activity towards ARF6. It may coordinate membrane trafficking with cell growth or actin cytoskeleton remodeling by binding to both SRC and PIP2 and may also function as a signal transduction protein involved in the differentiation of fibroblasts into adipocytes and possibly other cell types. It is widely expressed in most of the tissues. ASAP1 is a protooncogene involved in invasive breast cancer and in other types of invasive and malignant tumors, such as uveal melanomas.Specifications
Q9ULH1 | |
Blocking Assay, Control | |
50807 | |
100 μL | |
130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein; 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein; ADP-ribosylation factor-directed GTPase-activating protein 1; AMAP1; ARF GTPase-activating protein 1; arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1; ArfGAP with SH3 domain, ankyrin repeat and PH domain 1; ArfGAP with SH3 domain, ankyrin repeat and PH domain1; Asap1; AV239055; centaurin, beta 4; CENTB4; Ddef1; DEF-1; development and differentiation enhancing factor 1; development and differentiation-enhancing factor 1; differentiation enhancing factor 1; differentiation-enhancing factor 1; Kiaa1249; mKIAA1249; PAG2; PAP; PIP2-dependent ARF1 GAP; s19; Shag1; src SH3 binding protein; ZG14P | |
ASAP1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ASAP1 (aa 957-1078) Control Fragment | |
RUO | |
ASAP1 | |
Unconjugated | |
Recombinant | |
PKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDC | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |