missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ARSJ (aa 499-561) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104163
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57678 (PA5-57678. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ARSJ is a sulfatase that hydrolyzes sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. Sulfatases are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.Specifications
| Q5FYB0 | |
| Blocking Assay, Control | |
| 79642 | |
| 100 μL | |
| 9330196J05Rik; Arsj; arylsulfatase family member J; arylsulfatase family, member J; arylsulfatase J; ASJ; D830047F08; RGD1307640; UNQ372/PRO708 | |
| ARSJ | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ARSJ (aa 499-561) Control Fragment | |
| RUO | |
| ARSJ | |
| Unconjugated | |
| Recombinant | |
| TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |