missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ALX4 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105685
Description
Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64883 (PA5-64883. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a paired-like homeodomain transcription factor expressed in the mesenchyme of developing bones, limbs, hair, teeth, and mammary tissue. Mutations in this gene cause parietal foramina 2 (PFM2); an autosomal dominant disease characterized by deficient ossification of the parietal bones. Mutations in this gene also cause a form of frontonasal dysplasia with alopecia and hypogonadism; suggesting a role for this gene in craniofacial development, mesenchymal-epithelial communication, and hair follicle development. Deletion of a segment of chromosome 11 containing this gene, del(11)(p11p12), causes Potocki-Shaffer syndrome (PSS); a syndrome characterized by craniofacial anomalies, mental retardation, multiple exostoses, and genital abnormalities in males. In mouse, this gene has been shown to use dual translation initiation sites located 16 codons apart.Specifications
Q9H161 | |
Blocking Assay, Control | |
60529 | |
100 μL | |
ALX homeobox 4; ALX4; ALX-4; aristaless 4; Aristaless-like 4; aristaless-like homeobox 4; CRS5; FND2; Homeobox protein aristaless-like 4; homeodomain transcription factor ALX4; KIAA1788; lst; Strong's luxoid | |
ALX4 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ALX4 Control Fragment | |
RUO | |
ALX4 | |
Unconjugated | |
Recombinant | |
SPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQQDLATPLESGAGARGSFNKFQPQPSTPQPQPSPQPQPQQQQPQPQPPAQPHLYLQRGACKTPPDGSLKLQEGS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |