missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ALX3 (aa 90-149) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109400
Description
Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Aristaless-related genes are a group of paired-related homeobox genes which play a role in regulating vertebrate embryogenesis. The homeodomain transciption factor aristaless-like 3 (ALX3) is expressed in mouse embryos from 8 days of gestation, predominantly in neural crest-derived mesenchyme and in lateral plate mesoderm. Expression analysis of human and mouse tissue reveals predominant ALX3 expression in brain tissue. The Alx3 gene maps to chromosome 1p23-p13 and encodes a 343 amino acid protein. Preferential methylation of Alx3 occurs in advanced-stage neuroblastoma and may repress ALX3 expression. Treatment with the methylation inhibitor 5-aza-2'-deoxycytidine restores ALX3 expression. Alx3 (-) mice lack a phenotype distinct from wild-type mice, however Alx3/Alx4 double mutants demonstrate severe craniofacial abnormalities not present in Alx4 single mutants. Specifically, Alx3/Alx4 double mutant newborn mice have cleft nasal regions in addition to malformation of other neural crest-derived skull structures.Specifications
O95076 | |
Blocking Assay, Control | |
257 | |
100 μL | |
ALX homeobox 3; ALX3; aristaless 3; aristaless-like homeobox 3; FND; FND1; frontonasal dysplasia; homeobox protein aristaless-like 3; Proline-rich transcription factor ALX3 | |
ALX3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ALX3 (aa 90-149) Control Fragment | |
RUO | |
ALX3 | |
Unconjugated | |
Recombinant | |
PAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKN | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |