missing translation for 'onlineSavingsMsg'
Learn More

ATOH1, Mouse, Clone: 1A8, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant ATOH1.

Supplier: Abnova Corporation H00000474M11

Catalog No. 89-016-247

$411.81 / Each

Already have an account? Sign In to view your price and availability. New here? Register with us today!

Quantity

Description

This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. [provided by RefSeq

Sequence: MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCK

Specifications

Antigen	ATOH1
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_005172
Gene Symbols	ATOH1
Immunogen	ATOH1 (NP_005163, 1 a.a. ∼ 130 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG2b κ

Applications	ELISA, Western Blot
Clone	1A8
Description	Mouse monoclonal antibody raised against a full length recombinant ATOH1.
Gene	ATOH1
Gene Alias	ATH1/HATH1/MATH-1/bHLHa14
Host Species	Mouse
Purification Method	Affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	474
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Liquid

Product Suggestions

ATOH1, Mouse, Clone: 1A8, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions